PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000087.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family EIL
Protein Properties Length: 617aa    MW: 69309.4 Da    PI: 5.9831
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000087.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3439.82.4e-134614121334
                                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipe 79 
                                     eel++rmwkd+++lkr+ke++k   e++  a++++k ++s++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipe
  FANhyb_rscf00000087.1.g00001.1  61 EELERRMWKDRIKLKRIKEKQKL--EAQM-AAEKQKPRQSSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPE 136
                                     8**************99999886..4455.599********************************************** PP

                                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS- CS
                            EIN3  80 kgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdpp 158
                                     kgkpv+gasd++raWWkekv+fd+ngpaai+ky+a+ l++++++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdpp
  FANhyb_rscf00000087.1.g00001.1 137 KGKPVSGASDNIRAWWKEKVKFDKNGPAAIAKYEAEILAMTDADNN--RNGNSQSILQDLQDATLGSLLSSLMQHCDPP 213
                                     ************************************9999998888..68999999*********************** PP

                                     TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT CS
                            EIN3 159 qrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdk 237
                                     qr++plekgv+pPWWPtG+e+ww +lg+++ q+ ppykkphdlkk+wkv+vLtavikhmsp+i++ir+++rqsk+lqdk
  FANhyb_rscf00000087.1.g00001.1 214 QRKYPLEKGVPPPWWPTGNEDWWVKLGIPHGQS-PPYKKPHDLKKMWKVGVLTAVIKHMSPDIAKIRRHVRQSKCLQDK 291
                                     ********************************9.9******************************************** PP

                                     --SHHHHHHHHHHTTTTT-S--XXXXXX........XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX...... CS
                            EIN3 238 msakesfallsvlnqeekecatvsahss........slrkqspkvtlsceqkedvegkkeskikhvqavktta...... 302
                                     m+akes+++l vl++ee+++++ s+++            +++++ t+s ++++dv+g++++ i + +  ++ +      
  FANhyb_rscf00000087.1.g00001.1 292 MTAKESAIWLGVLSREEALIRQPSSDNGtsgitemlCRGRGEKHATASGNSDYDVDGTDKELIDAGSVSSKDDrrteli 370
                                     **************************444567776433349999************88888876433333333567899 PP

                                     ..........XXXXXXXXXXXXXXXXXXXXX......XXXXX CS
                            EIN3 303 ..........gfpvvrkrkkkpsesakvsskevsrtcqssqf 334
                                               g+++++ ++k+++e++k  +k  +r     q+
  FANhyb_rscf00000087.1.g00001.1 371 dvepssnlrnGTTTNHVQDKEKGEKRKKRKKAPVRPSSDDQL 412
                                     999999999966666666666677776666666666666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.8E-12761308No hitNo description
Gene3DG3DSA:1.10.3180.102.0E-72182316IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.72E-63189312IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
MQIKLKWVTL ERLDLKLAKL NESVCFTECM LSSAANSDIE EDLRCDNIAE KDVSDEEIDP  60
EELERRMWKD RIKLKRIKEK QKLEAQMAAE KQKPRQSSDQ ARRKKMSRAQ DGILKYMLKL  120
MEVCKARGFV YGIIPEKGKP VSGASDNIRA WWKEKVKFDK NGPAAIAKYE AEILAMTDAD  180
NNRNGNSQSI LQDLQDATLG SLLSSLMQHC DPPQRKYPLE KGVPPPWWPT GNEDWWVKLG  240
IPHGQSPPYK KPHDLKKMWK VGVLTAVIKH MSPDIAKIRR HVRQSKCLQD KMTAKESAIW  300
LGVLSREEAL IRQPSSDNGT SGITEMLCRG RGEKHATASG NSDYDVDGTD KELIDAGSVS  360
SKDDRRTELI DVEPSSNLRN GTTTNHVQDK EKGEKRKKRK KAPVRPSSDD QLPAPIVSEH  420
MHVEPINALL DINHTDAQMI GFPIHEDHQE NVSVTTLRPP EHDLGVQALP ASGFNYYADV  480
PDDGALATTQ SMHVGGTPML YYGVQSAEMH HGNMFDLYNP SAEYVPGHER QQSQIVMNEP  540
QIGPADGVPI QTVRNGNEIT GGDLPFYKDP FLSEQDRMVD PNFDLGVIFN SPFRPDLGFE  600
GTASFDDELD VMSYFAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-761883199140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1394400KRKKRKK
2396400KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295232.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLM5WRR10.0M5WRR1_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s05360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.10.0ETHYLENE-INSENSITIVE3-like 3